Crystal structure of the apo pps phd finger
PDB DOI: 10.2210/pdb5wlf/pdb
Classification: HYDROLASE Organism(s): Drosophila Melanogaster
Deposited: 2017-07-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of the apo pps phd finger
Klein, B.J. , Kutateladze, T.G.
Primary Citation of Related Structures: 5WLF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein partner of snf, isoform A | A | 62 | Drosophila Melanogaster | GPLPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPKCVKRQE |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.