Crystal structure of the pps phd finger in complex with h3k4me3
PDB DOI: 10.2210/pdb5wle/pdb
Classification: HYDROLASE Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2017-07-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.
Method: X-RAY DIFFRACTION Resolution: 1.952 Å
Crystal structure of the pps phd finger in complex with h3k4me3
Klein, B.J. , Kutateladze, T.G.
Primary Citation of Related Structures: 5WLE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein partner of snf, isoform A | A | 63 | Drosophila Melanogaster , Synthetic Construct | GDDDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPKCVKRQ |
H3K4me3 Peptide | C | 12 | Drosophila Melanogaster , Synthetic Construct | ARTKQTARKSTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.