Solution nmr structure of paurtx-3
PDB DOI: 10.2210/pdb5we3/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2017-07-06 Deposition Author(s): Agwa, A.J. , Schroeder, C.I.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of paurtx-3
Primary Citation of Related Structures: 5WE3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-theraphotoxin-Ps1a | A | 34 | N.A. | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI |
Method: SOLUTION NMR
Deposited Date: 2017-07-06 Deposition Author(s): Agwa, A.J. , Schroeder, C.I.