Crystal structure of the first bromodomain of human brd4 in complex with the inhibitor jwg048
PDB DOI: 10.2210/pdb5w55/pdb
Classification: CELL CYCLE Organism(s): Homo Sapiens
Deposited: 2017-06-14 Deposition Author(s): Blacklow, S.C. , Xu, X.
Crystal structure of the first bromodomain of human brd4 in complex with the inhibitor jwg048
Primary Citation of Related Structures: 5W55
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Bromodomain-containing protein 4 | A | 127 | Homo Sapiens | STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE | 
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-14 Deposition Author(s): Blacklow, S.C. , Xu, X.
 
                  