Structure of pin1 ww domain variant 1 with beta3-ser loop substitution
PDB DOI: 10.2210/pdb5vtk/pdb
Classification: PROTEIN BINDING Organism(s): N.A.
Deposited: 2017-05-17 Deposition Author(s): Forest, K.T. , Gellman, S.H. , Kreitler, D.F. , Mortenson, D.E. , Thomas, N.C.
Structure of pin1 ww domain variant 1 with beta3-ser loop substitution
Forest, K.T. , Gellman, S.H. , Kreitler, D.F. , Mortenson, D.E. , Thomas, N.C.
Primary Citation of Related Structures: 5VTK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 34 | N.A. | KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-17 Deposition Author(s): Forest, K.T. , Gellman, S.H. , Kreitler, D.F. , Mortenson, D.E. , Thomas, N.C.