Advanced Search:
5VS7
Bromodomain of pf3d7_1475600 from plasmodium falciparum complexed with peptide h4k5ac
PDB DOI: 10.2210/pdb5vs7/pdb
Classification: SIGNALING PROTEIN Organism(s): Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-05-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Hou, C.F.D. , Hui, R. , Loppnau, P. , Structural Genomics Consortium (Sgc) , Walker, J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.04 Å
Bromodomain of pf3d7_1475600 from plasmodium falciparum complexed with peptide h4k5ac
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Hou, C.F.D. , Hui, R. , Loppnau, P. , Structural Genomics Consortium (Sgc) , Walker, J.R.
Primary Citation of Related Structures: 5VS7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain protein, putative | A | 119 | Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GYDEIEELKSKNEVLTNLLNKLIAFDKKRIFLYPVNVQLVPDYLNVIKEPMDFTTMKQKLQNFKYKSFQEFEKDVLLIINNCYTYNDPSTIYYKFAEDIETYYKKLNIKIQTKYMNIHL |
| H4K5ac peptide | P | 7 | Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GRGKGGK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Hou, C.F.D. , Hui, R. , Loppnau, P. , Structural Genomics Consortium (Sgc) , Walker, J.R.