Structure of human sts-1 histidine phosphatase domain with sulfate bound
PDB DOI: 10.2210/pdb5vr6/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2017-05-10 Deposition Author(s): Carpino, N. , French, J.B. , Kaur, N. , Weinheimer, A.W. , Yin, Y. , Zhou, W.
Structure of human sts-1 histidine phosphatase domain with sulfate bound
Carpino, N. , French, J.B. , Kaur, N. , Weinheimer, A.W. , Yin, Y. , Zhou, W.
Primary Citation of Related Structures: 5VR6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin-associated and SH3 domain-containing protein B | A | 266 | Homo Sapiens | RCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE |
| Ubiquitin-associated and SH3 domain-containing protein B | B | 266 | Homo Sapiens | RCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-10 Deposition Author(s): Carpino, N. , French, J.B. , Kaur, N. , Weinheimer, A.W. , Yin, Y. , Zhou, W.