Crystal structure of dm14-3 domain of lgd
PDB DOI: 10.2210/pdb5vny/pdb
Classification: ENDOCYTOSIS, PROTEIN BINDING Organism(s): Drosophila Melanogaster
Deposited: 2017-05-01 Deposition Author(s): Blacklow, S.C. , Mcmillan, B.J.
Crystal structure of dm14-3 domain of lgd
Blacklow, S.C. , Mcmillan, B.J.
Primary Citation of Related Structures: 5VNY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lethal (2) giant discs 1, isoform B | A | 66 | Drosophila Melanogaster | STNMLEALQQRLEKYQSVEAAAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPVPPGFG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-01 Deposition Author(s): Blacklow, S.C. , Mcmillan, B.J.