Kaiso (zbtb33) e535q mutant zinc finger dna binding domain in complex with a double cpg-methylated dna resembling the specific kaiso binding sequence (kbs)
PDB DOI: 10.2210/pdb5vmz/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-04-28 Deposition Author(s): Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.
Kaiso (zbtb33) e535q mutant zinc finger dna binding domain in complex with a double cpg-methylated dna resembling the specific kaiso binding sequence (kbs)
Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.
Primary Citation of Related Structures: 5VMZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional regulator Kaiso | A | 134 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAQYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-28 Deposition Author(s): Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.