Crystal structure of grouper iridovirus giv66:bim complex
PDB DOI: 10.2210/pdb5vmo/pdb
Classification: VIRAL PROTEIN/apoptosis Organism(s): Adeno-Associated Virus - Po1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-04-28 Deposition Author(s): Banjara, S. , Kvansakul, M.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of grouper iridovirus giv66:bim complex
Primary Citation of Related Structures: 5VMO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bak protein | A | 132 | Adeno-Associated Virus - Po1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSMTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKSESESERTQITEQLERFFRQDAISNWIASNGGWVTCASLDLRNYSSVT |
Bcl-2 interacting mediator of cell death | B | 26 | Adeno-Associated Virus - Po1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ALPPEMVVARELRRIGDEFNRLYCEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-28 Deposition Author(s): Banjara, S. , Kvansakul, M.