Crystal structure of the first bromodomain of human brdt in complex with bi2536
PDB DOI: 10.2210/pdb5vbq/pdb
Classification: TRANSCRIPTION/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2017-03-30 Deposition Author(s): Ember, S.W. , Schonbrunn, E. , Zhu, J.-Y.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Crystal structure of the first bromodomain of human brdt in complex with bi2536
Ember, S.W. , Schonbrunn, E. , Zhu, J.-Y.
Primary Citation of Related Structures: 5VBQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain testis-specific protein | A | 113 | Homo Sapiens | GAASTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
| Bromodomain testis-specific protein | B | 113 | Homo Sapiens | GAASTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-30 Deposition Author(s): Ember, S.W. , Schonbrunn, E. , Zhu, J.-Y.