5VB9
Il-17a in complex with peptide
PDB DOI: 10.2210/pdb5vb9/pdb
Classification: IMMUNE SYSTEM / INHIBITOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-03-28 Deposition Author(s): Afshar, S. , Antonysamy, S. , Benach, J. , Bina, H. , Broughton, H. , Chalmers, M. , Dodge, J. , Espada, A. , Groshong, C. , Jones, S. , Lu, F. , Manglicmot, D. , Russell, M. , Ting, J.P. , Wasserman, S.R. , Woodman, M. , Zhang, A. , Zhang, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Il-17a in complex with peptide
Afshar, S. , Antonysamy, S. , Benach, J. , Bina, H. , Broughton, H. , Chalmers, M. , Dodge, J. , Espada, A. , Groshong, C. , Jones, S. , Lu, F. , Manglicmot, D. , Russell, M. , Ting, J.P. , Wasserman, S.R. , Woodman, M. , Zhang, A. , Zhang, F.
Primary Citation of Related Structures: 5VB9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interleukin-17A | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHVA |
| Interleukin-17A | B | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHVA |
| Peptide inhibitor | C | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CWVLEYDMFGALHCR |
| Peptide inhibitor | D | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CWVLEYDMFGALHCR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-28 Deposition Author(s): Afshar, S. , Antonysamy, S. , Benach, J. , Bina, H. , Broughton, H. , Chalmers, M. , Dodge, J. , Espada, A. , Groshong, C. , Jones, S. , Lu, F. , Manglicmot, D. , Russell, M. , Ting, J.P. , Wasserman, S.R. , Woodman, M. , Zhang, A. , Zhang, F.