Crystal structure of atxr5 set domain in complex with k36me3 histone h3 peptide
PDB DOI: 10.2210/pdb5vac/pdb
Classification: TRANSFERASE/DNA BINDING PROTEIN Organism(s): Ricinus Communis , Synthetic Construct
Deposited: 2017-03-24 Deposition Author(s): Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.
Crystal structure of atxr5 set domain in complex with k36me3 histone h3 peptide
Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.
Primary Citation of Related Structures: 5VAC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable Histone-lysine N-methyltransferase ATXR5 | A | 229 | Ricinus Communis , Synthetic Construct | RRRSGSLVYQKRRRRLLPFVSSEDPAQRLKQMGTLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGDCPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDYIRNREHDDCDSMMTLLLAKDPSSSLVICPDKRGNIARFISGINNHTLDGKKKQNCKCVRYSVNGECRVFLVATRDIAKGERLYYDYNGYEHEYPTQHFV |
| Histone H3.2 | C | 19 | Ricinus Communis , Synthetic Construct | KQLATKAARKSAPATGGVK |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-24 Deposition Author(s): Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.