Crystal structure of atxr5 phd domain in complex with histone h3
PDB DOI: 10.2210/pdb5vab/pdb
Classification: TRANSFERASE/DNA BINDING PROTEIN Organism(s): Paracoccus Laeviglucosivorans Nakamura 2015 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-03-24 Deposition Author(s): Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.-F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.
Crystal structure of atxr5 phd domain in complex with histone h3
Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.-F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.
Primary Citation of Related Structures: 5VAB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ATXR5 PHD domain | A | 58 | Paracoccus Laeviglucosivorans Nakamura 2015 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGSVSCEECGGGHSPSKLLLCDKCDRGYHLFCLRPILPSVPKGSWFCPSCSNHKPK |
Histone H3 peptide | F | 11 | Paracoccus Laeviglucosivorans Nakamura 2015 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSY |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-24 Deposition Author(s): Bergamin, E. , Blais, A. , Brunzelle, J.S. , Couture, J.-F. , Eram, M. , Joshi, M. , Malette, J. , Michaels, S.D. , Mongeon, V. , Sarvan, S. , Vedadi, M. , Yeung, S.