Crystal structure of nedd4 lir-fused human lc3b_2-119
PDB DOI: 10.2210/pdb5v4k/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2017-03-09 Deposition Author(s): Qiu, Y. , Schulman, B. , Zheng, Y.
Method: X-RAY DIFFRACTION Resolution: 2.099 Å
Crystal structure of nedd4 lir-fused human lc3b_2-119
Qiu, Y. , Schulman, B. , Zheng, Y.
Primary Citation of Related Structures: 5V4K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B | A | 132 | Homo Sapiens | GSQESSENWEIIGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF |
Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B | B | 132 | Homo Sapiens | GSQESSENWEIIGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-09 Deposition Author(s): Qiu, Y. , Schulman, B. , Zheng, Y.