Prolyl isomerase pin1 r14a mutant bound with brd4 peptide
PDB DOI: 10.2210/pdb5uy9/pdb
Classification: ISOMERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-02-23 Deposition Author(s): Dong, S.-H. , Nair, S.
Prolyl isomerase pin1 r14a mutant bound with brd4 peptide
Primary Citation of Related Structures: 5UY9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 163 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
Brd4 peptide | B | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QASTPRX |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-23 Deposition Author(s): Dong, S.-H. , Nair, S.