Crystal structure of a peptidoglycan glycosyltransferase from burkholderia ambifaria
PDB DOI: 10.2210/pdb5uy7/pdb
Classification: TRANSFERASE Organism(s): Burkholderia Ambifaria
Deposited: 2017-02-23 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of a peptidoglycan glycosyltransferase from burkholderia ambifaria
Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5UY7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidoglycan glycosyltransferase | A | 579 | Burkholderia Ambifaria | MAHHHHHHAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPDAVPDDLGADKINQLGKLLGMTPKELRVKLSEDKGFVYVKRQVPIDVADKVAALDIPGIYQRNEYKRFYPEGEITAHLIGFTNVEDEGQEGVELGDQKLLSGTSGVRRVIKDRLGHIVEDVAEQVPPHNGTDVGLSIDSKIQYIAYANLKAAVEKFKAKAGAAMVVDVRTGEVLALVNYPTYNPNDRTRLTGEQLRNRILTDVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDGAPITDDAGFGTLTVGGVIQKSSNIGATKIAMTMRPEEMWNMYTSIGLGQAPKVGFPGAAAGRLRPWKSWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGEMMPVTIFKTDPNQQITGTQVFTPTTAREVRTMLETVVAPGGTSPDAAVPGYRVGGKSGTAYKHEGHGYTRKYRASFVGMAPMPNPRIVVAVSVDEPTAGSHFGGQVSGPVFSAIAGDTMRALNVPPNMPIKQLVVSDDAPGAPAKPGPQKLAAGSGAKHMIVSSTTRNSPGVVR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-23 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)