Insulin with proline analog thiop at position b28 in the r6 state
PDB DOI: 10.2210/pdb5uu4/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2017-02-16 Deposition Author(s): Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Method: X-RAY DIFFRACTION Resolution: 1.973 Å
Insulin with proline analog thiop at position b28 in the r6 state
Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Primary Citation of Related Structures: 5UU4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A Chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin A Chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B Chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin B Chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-16 Deposition Author(s): Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.