Insulin with proline analog thiop at position b28 in the t2 state
PDB DOI: 10.2210/pdb5uu2/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2017-02-15 Deposition Author(s): Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Method: X-RAY DIFFRACTION Resolution: 1.223 Å
Insulin with proline analog thiop at position b28 in the t2 state
Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Primary Citation of Related Structures: 5UU2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin Chain A | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin Chain B | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-15 Deposition Author(s): Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.