Hiv-1 wild type protease with grl-1118a , an isophthalamide-derived p2-p3 ligand with the sulfonamide isostere as the p2' group
PDB DOI: 10.2210/pdb5uov/pdb
Classification: hydrolase/hydrolase inhibitor Organism(s): Human Immunodeficiency Virus 1
Deposited: 2017-02-01 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Method: X-RAY DIFFRACTION Resolution: 1.33 Å
Hiv-1 wild type protease with grl-1118a , an isophthalamide-derived p2-p3 ligand with the sulfonamide isostere as the p2' group
Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Primary Citation of Related Structures: 5UOV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-01 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.