Crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii
PDB DOI: 10.2210/pdb5um7/pdb
Classification: OXIDOREDUCTASE Organism(s): Streptococcus Gordonii (Strain Challis / Atcc 35105 / Bcrc 15272 / Ch1 / Dl1 / V288)
Deposited: 2017-01-26 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Evdokimova, E. , Savchenko, A. , Stogios, P.J. , Wawrzak, Z. , Yim, V.
Method: X-RAY DIFFRACTION Resolution: 1.62 Å
Crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii
Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Evdokimova, E. , Savchenko, A. , Stogios, P.J. , Wawrzak, Z. , Yim, V.
Primary Citation of Related Structures: 5UM7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin signature protein | A | 187 | Streptococcus Gordonii (Strain Challis / Atcc 35105 / Bcrc 15272 / Ch1 / Dl1 / V288) | MLKEKWWLPFLTVGVILVAVFALFYIAGPNRHNKGSTQKDGSSAVEHELTGQQLPEFEMVDQAGYQKKSAEFYNKPMLVVEWASWCPDCQKQLPEIQKVYEKYKGKIHFVMLDMLDSKRETKERADQYISEKDYTFPYYYDTDERAADILHVQSIPTIYLVDKNQKVKKVMTDFHDEAALEKQLEEI |
| Thioredoxin signature protein | B | 187 | Streptococcus Gordonii (Strain Challis / Atcc 35105 / Bcrc 15272 / Ch1 / Dl1 / V288) | MLKEKWWLPFLTVGVILVAVFALFYIAGPNRHNKGSTQKDGSSAVEHELTGQQLPEFEMVDQAGYQKKSAEFYNKPMLVVEWASWCPDCQKQLPEIQKVYEKYKGKIHFVMLDMLDSKRETKERADQYISEKDYTFPYYYDTDERAADILHVQSIPTIYLVDKNQKVKKVMTDFHDEAALEKQLEEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-01-26 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Evdokimova, E. , Savchenko, A. , Stogios, P.J. , Wawrzak, Z. , Yim, V.