The molecular mechanisms by which ns1 of the 1918 spanish influenza a virus hijack host protein-protein interactions
PDB DOI: 10.2210/pdb5ul6/pdb
Classification: VIRAL PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-01-24 Deposition Author(s): Cho, J.H. , Li, P. , Shen, Q. , Zeng, D. , Zhao, B.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Adapter molecule crk | A | 58 | Homo Sapiens , Synthetic Construct | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR |
| Proline-rich motif of nonstructural protein 1 of influenza a virus | M | 15 | Homo Sapiens , Synthetic Construct | XYGRPPLPPKQKRKX |
Method: X-RAY DIFFRACTION