Nmr solution structure of the two-component bacteriocin cbnxy
PDB DOI: 10.2210/pdb5ujr/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Carnobacterium Maltaromaticum
Deposited: 2017-01-18 Deposition Author(s): Acedo, J.Z. , Doerksen, T. , Lohans, C.T. , Martin-Visscher, L.A. , Mckay, R.T. , Miskolzie, M. , Towle, K.M. , Vederas, J.C.
Nmr solution structure of the two-component bacteriocin cbnxy
Acedo, J.Z. , Doerksen, T. , Lohans, C.T. , Martin-Visscher, L.A. , Mckay, R.T. , Miskolzie, M. , Towle, K.M. , Vederas, J.C.
Primary Citation of Related Structures: 5UJR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacteriocin | A | 33 | Carnobacterium Maltaromaticum | WGWKEVVQNGQTIFSAGQKLGNMVGKIVPLPFG |
Method: SOLUTION NMR
Deposited Date: 2017-01-18 Deposition Author(s): Acedo, J.Z. , Doerksen, T. , Lohans, C.T. , Martin-Visscher, L.A. , Mckay, R.T. , Miskolzie, M. , Towle, K.M. , Vederas, J.C.