Crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus
PDB DOI: 10.2210/pdb5uft/pdb
Classification: METAL BINDING PROTEIN Organism(s): Brucella Abortus (Strain 2308)
Deposited: 2017-01-05 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Method: X-RAY DIFFRACTION Resolution: 2.35 Å
Crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5UFT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nitrogen-fixing NifU-like, N-terminal | A | 150 | Brucella Abortus (Strain 2308) | GPGSMIDDIYNKRILEFAGNMERIGQLAEPDAVATVHSKLCGSTVTVYLKMRDGVVTDFAHEVKACALGQASSSVMARNVIGATADELRAARDAMYRMLKENGPAPEGRFADMKYFEPVRDYKARHASTLLTFDAVADCIRQIEEKAKAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-01-05 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)