Crystal structure of the trna binding domain of pyrrolysyl-trna synthetase bound to trna(pyl)
PDB DOI: 10.2210/pdb5ud5/pdb
Classification: LIGASE/RNA Organism(s): Methanosarcina Mazei (Strain Atcc Baa-159 / Dsm 3647 / Goe1 / Go1 / Jcm 11833 / Ocm 88) , Synthetic Construct
Deposited: 2016-12-23 Deposition Author(s): Soll, D. , Suzuki, T.
Crystal structure of the trna binding domain of pyrrolysyl-trna synthetase bound to trna(pyl)
Primary Citation of Related Structures: 5UD5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Pyrrolysine--tRNA ligase | A | 109 | Methanosarcina Mazei (Strain Atcc Baa-159 / Dsm 3647 / Goe1 / Go1 / Jcm 11833 / Ocm 88) , Synthetic Construct | MGHHHHHHMDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAP |
Pyrrolysine--tRNA ligase | B | 109 | Methanosarcina Mazei (Strain Atcc Baa-159 / Dsm 3647 / Goe1 / Go1 / Jcm 11833 / Ocm 88) , Synthetic Construct | MGHHHHHHMDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAP |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-12-23 Deposition Author(s): Soll, D. , Suzuki, T.