Solution nmr structure of nerd-c, a natively folded tetramutant of the b1 domain of streptococcal protein g (gb1)
PDB DOI: 10.2210/pdb5ub0/pdb
Classification: DE NOVO PROTEIN Organism(s): Streptococcus Sp. Gx7805
Deposited: 2016-12-20 Deposition Author(s): Chica, R.A. , Damry, A.M. , Davey, J.A. , Goto, N.K.
Solution nmr structure of nerd-c, a natively folded tetramutant of the b1 domain of streptococcal protein g (gb1)
Chica, R.A. , Damry, A.M. , Davey, J.A. , Goto, N.K.
Primary Citation of Related Structures: 5UB0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G-binding protein G | A | 56 | Streptococcus Sp. Gx7805 | MTFKLIINGKTLKGETTTEAVDAATAEKVLKQYANDNGIDGEWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2016-12-20 Deposition Author(s): Chica, R.A. , Damry, A.M. , Davey, J.A. , Goto, N.K.