5U6I
Discovery of mli-2, an orally available and selective lrrk2 inhibitor that reduces brain kinase activity
PDB DOI: 10.2210/pdb5u6i/pdb
Classification: TRANSFERASE/TRANSFERASE INHIBITOR Organism(s): Rattus Norvegicus
Deposited: 2016-12-08 Deposition Author(s): Agnihotri, G. , Baptista, M. , Basu, K. , Chang, R.K. , Columbus, J. , Dai, X. , Demong, D.E. , Drolet, R.E. , Embrey, M.W. , Fell, M.J. , Greshock, T.J. , Harris, J. , Hruza, A. , Kennedy, M.E. , Kern, J.T. , Li, W. , Lin, S. , Lin, Y. , Liu, H. , Mccauley, J.A. , Mei, H. , Miller, M.W. , Mirescu, C. , Morrow, J.A. , Nargund, R. , Parker, E.M. , Poirier, M. , Sanders, J.M. , Scott, J.D. , Stamford, A.W. , Tiscia, H.E. , Xiao, L. , Yin, Z. , Zhou, X.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.69 Å
Discovery of mli-2, an orally available and selective lrrk2 inhibitor that reduces brain kinase activity
Agnihotri, G. , Baptista, M. , Basu, K. , Chang, R.K. , Columbus, J. , Dai, X. , Demong, D.E. , Drolet, R.E. , Embrey, M.W. , Fell, M.J. , Greshock, T.J. , Harris, J. , Hruza, A. , Kennedy, M.E. , Kern, J.T. , Li, W. , Lin, S. , Lin, Y. , Liu, H. , Mccauley, J.A. , Mei, H. , Miller, M.W. , Mirescu, C. , Morrow, J.A. , Nargund, R. , Parker, E.M. , Poirier, M. , Sanders, J.M. , Scott, J.D. , Stamford, A.W. , Tiscia, H.E. , Xiao, L. , Yin, Z. , Zhou, X.
Primary Citation of Related Structures: 5U6I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase 1 | A | 366 | Rattus Norvegicus | MAHHHHHHMAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-12-08 Deposition Author(s): Agnihotri, G. , Baptista, M. , Basu, K. , Chang, R.K. , Columbus, J. , Dai, X. , Demong, D.E. , Drolet, R.E. , Embrey, M.W. , Fell, M.J. , Greshock, T.J. , Harris, J. , Hruza, A. , Kennedy, M.E. , Kern, J.T. , Li, W. , Lin, S. , Lin, Y. , Liu, H. , Mccauley, J.A. , Mei, H. , Miller, M.W. , Mirescu, C. , Morrow, J.A. , Nargund, R. , Parker, E.M. , Poirier, M. , Sanders, J.M. , Scott, J.D. , Stamford, A.W. , Tiscia, H.E. , Xiao, L. , Yin, Z. , Zhou, X.