5TQ1
Phospholipase c gamma-1 c-terminal sh2 domain bound to a phosphopeptide derived from the insulin receptor
PDB DOI: 10.2210/pdb5tq1/pdb
Classification: HYDROLASE Organism(s): Bos Taurus , Synthetic Construct
Deposited: 2016-10-21 Deposition Author(s): Mckercher, M.A. , Wuttke, D.S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.485 Å
Phospholipase c gamma-1 c-terminal sh2 domain bound to a phosphopeptide derived from the insulin receptor
Mckercher, M.A. , Wuttke, D.S.
Primary Citation of Related Structures: 5TQ1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 | A | 101 | Bos Taurus , Synthetic Construct | GSHMHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEE |
| Insulin receptor | B | 11 | Bos Taurus , Synthetic Construct | PSSVYVPDEWE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-10-21 Deposition Author(s): Mckercher, M.A. , Wuttke, D.S.