Solution structure of the n-terminal dna-binding domain of the master biofilm-regulator sinr from bacillus subtilis
PDB DOI: 10.2210/pdb5tn0/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis (Strain 168)
Deposited: 2016-10-13 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Draughn, G.L. , Stowe, S.D. , Thompson, R.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the n-terminal dna-binding domain of the master biofilm-regulator sinr from bacillus subtilis
Bobay, B.G. , Cavanagh, J. , Draughn, G.L. , Stowe, S.D. , Thompson, R.J.
Primary Citation of Related Structures: 5TN0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator SinR | A | 69 | Bacillus Subtilis (Strain 168) | MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETE |
Method: SOLUTION NMR
Deposited Date: 2016-10-13 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Draughn, G.L. , Stowe, S.D. , Thompson, R.J.