Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (cftr) with utp
PDB DOI: 10.2210/pdb5tff/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2016-09-25 Deposition Author(s): Aleksandrov, A.A. , An, J. , Boel, G. , Brouillette, C.G. , Dokholyan, N.V. , Forouhar, F. , Hunt, J.F. , Kaplan, A. , Khazanov, N. , Kota, P. , Proctor, E. , Riordan, J.R. , Senderowitz, H. , Stockwell, B.R. , Wang, C. , Yang, Z.
Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (cftr) with utp
Aleksandrov, A.A. , An, J. , Boel, G. , Brouillette, C.G. , Dokholyan, N.V. , Forouhar, F. , Hunt, J.F. , Kaplan, A. , Khazanov, N. , Kota, P. , Proctor, E. , Riordan, J.R. , Senderowitz, H. , Stockwell, B.R. , Wang, C. , Yang, Z.
Primary Citation of Related Structures: 5TFF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cystic fibrosis transmembrane conductance regulator | A | 229 | Homo Sapiens | SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-25 Deposition Author(s): Aleksandrov, A.A. , An, J. , Boel, G. , Brouillette, C.G. , Dokholyan, N.V. , Forouhar, F. , Hunt, J.F. , Kaplan, A. , Khazanov, N. , Kota, P. , Proctor, E. , Riordan, J.R. , Senderowitz, H. , Stockwell, B.R. , Wang, C. , Yang, Z.