Set3 phd finger in complex with histone h3k4me3
PDB DOI: 10.2210/pdb5tdw/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct
Deposited: 2016-09-19 Deposition Author(s): Ali, M. , Andrews, F.H. , Kutateladze, T.G.
Set3 phd finger in complex with histone h3k4me3
Ali, M. , Andrews, F.H. , Kutateladze, T.G.
Primary Citation of Related Structures: 5TDW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SET domain-containing protein 3 | A | 69 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK |
histone H3K4me3 | B | 11 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | ARTKQTARKST |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-19 Deposition Author(s): Ali, M. , Andrews, F.H. , Kutateladze, T.G.