Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
PDB DOI: 10.2210/pdb5t6j/pdb
Classification: CELL CYCLE Organism(s): Saccharomyces Cerevisiae , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C)
Deposited: 2016-09-01 Deposition Author(s): Dimitrova, Y. , Harrison, S.C. , Jenni, S. , Khin, Y. , Valverde, R.
Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
Dimitrova, Y. , Harrison, S.C. , Jenni, S. , Khin, Y. , Valverde, R.
Primary Citation of Related Structures: 5T6J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kinetochore protein SPC24 | A | 59 | Saccharomyces Cerevisiae , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK |
| Kinetochore protein SPC25 | B | 92 | Saccharomyces Cerevisiae , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | SNANDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL |
| Kinetochore-associated protein DSN1 | C | 13 | Saccharomyces Cerevisiae , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | QQLLKGLSLSFSK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-01 Deposition Author(s): Dimitrova, Y. , Harrison, S.C. , Jenni, S. , Khin, Y. , Valverde, R.