Crystal structure of the bromodomain of human brpf1 in complex with a quinolinone ligand
PDB DOI: 10.2210/pdb5t4u/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2016-08-30 Deposition Author(s): Arrowsmith, C.H. , Bayle, E.D. , Bountra, C. , Brennan, P.E. , Edwards, A.M. , Fedorov, O. , Fish, P. , Igoe, N. , Knapp, S. , Mathea, S. , Muller, S. , Newman, J.A. , Nunez-Alonso, G. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of the bromodomain of human brpf1 in complex with a quinolinone ligand
Arrowsmith, C.H. , Bayle, E.D. , Bountra, C. , Brennan, P.E. , Edwards, A.M. , Fedorov, O. , Fish, P. , Igoe, N. , Knapp, S. , Mathea, S. , Muller, S. , Newman, J.A. , Nunez-Alonso, G. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 5T4U
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peregrin | A | 116 | Homo Sapiens | SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-30 Deposition Author(s): Arrowsmith, C.H. , Bayle, E.D. , Bountra, C. , Brennan, P.E. , Edwards, A.M. , Fedorov, O. , Fish, P. , Igoe, N. , Knapp, S. , Mathea, S. , Muller, S. , Newman, J.A. , Nunez-Alonso, G. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.