5T3M
Solution structure of a triple mutant of hwtx-iv - a potent blocker of nav1.7
PDB DOI: 10.2210/pdb5t3m/pdb
Classification: TOXIN Organism(s): Haplopelma Schmidti
Deposited: 2016-08-25 Deposition Author(s): Mobli, M. , Rahnama, S. , Sharma, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a triple mutant of hwtx-iv - a potent blocker of nav1.7
Mobli, M. , Rahnama, S. , Sharma, G.
Primary Citation of Related Structures: 5T3M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mu-theraphotoxin-Hs2a | A | 35 | Haplopelma Schmidti | GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2016-08-25 Deposition Author(s): Mobli, M. , Rahnama, S. , Sharma, G.