Cbx3 chromo shadow domain in complex with histone h3 peptide
PDB DOI: 10.2210/pdb5t1i/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-08-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Cbx3 chromo shadow domain in complex with histone h3 peptide
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 5T1I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 3 | A | 68 | Homo Sapiens , Synthetic Construct | GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS |
| Chromobox protein homolog 3 | B | 68 | Homo Sapiens , Synthetic Construct | GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS |
| Histone H3.1 | C | 15 | Homo Sapiens , Synthetic Construct | PHRYRPGTVALREIR |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.