Crystal structure of the myc3 n-terminal domain [44-242] in complex with jaz10 cmid domain [16-58] from arabidopsis
PDB DOI: 10.2210/pdb5t0f/pdb
Classification: TRANSCRIPTION Organism(s): Arabidopsis Thaliana
Deposited: 2016-08-16 Deposition Author(s): Brunzelle, J.S. , He, S.Y. , Ke, J. , Melcher, K. , Xu, H.E. , Zhang, F.
Crystal structure of the myc3 n-terminal domain [44-242] in complex with jaz10 cmid domain [16-58] from arabidopsis
Brunzelle, J.S. , He, S.Y. , Ke, J. , Melcher, K. , Xu, H.E. , Zhang, F.
Primary Citation of Related Structures: 5T0F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor MYC3 | A | 199 | Arabidopsis Thaliana | QPQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEEDKEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNGVGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSEVISQSSDLMHKVNNLFNFNNGGG |
| Protein TIFY 9 | B | 43 | Arabidopsis Thaliana | KQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLAST |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-16 Deposition Author(s): Brunzelle, J.S. , He, S.Y. , Ke, J. , Melcher, K. , Xu, H.E. , Zhang, F.