Epstein-barr virus zta dna binding domain homodimer in complex with methylated dna
PDB DOI: 10.2210/pdb5szx/pdb
Classification: TRANSCRIPTION REGULATOR/DNA Organism(s): Epstein-Barr Virus , Synthetic Construct
Deposited: 2016-08-15 Deposition Author(s): Cheng, X. , Hong, S. , Horton, J.R.
Method: X-RAY DIFFRACTION Resolution: 2.251 Å
Epstein-barr virus zta dna binding domain homodimer in complex with methylated dna
Cheng, X. , Hong, S. , Horton, J.R.
Primary Citation of Related Structures: 5SZX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zta transcription factor | A | 62 | Epstein-Barr Virus , Synthetic Construct | LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
| Zta transcription factor | B | 62 | Epstein-Barr Virus , Synthetic Construct | LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-15 Deposition Author(s): Cheng, X. , Hong, S. , Horton, J.R.