Humanized rat catechol o-methyltransferase in complex with 5-(4-fluorophenyl)-2,3-dihydroxy-n-[[3-[(1h-indazol-5-ylamino)methyl]phenyl]methyl]benzamide at 1.20a
PDB DOI: 10.2210/pdb5p94/pdb
Classification: TRANSFERASE/TRANSFERASE inhibitor Organism(s): Rattus Norvegicus
Deposited: 2016-08-29 Deposition Author(s): Ehler, A. , Lerner, C. , Rudolph, M.G.
Humanized rat catechol o-methyltransferase in complex with 5-(4-fluorophenyl)-2,3-dihydroxy-n-[[3-[(1h-indazol-5-ylamino)methyl]phenyl]methyl]benzamide at 1.20a
Ehler, A. , Lerner, C. , Rudolph, M.G.
Primary Citation of Related Structures: 5P94
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Catechol O-methyltransferase | A | 221 | Rattus Norvegicus | MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-29 Deposition Author(s): Ehler, A. , Lerner, C. , Rudolph, M.G.