Pdz domain from rat shank3 bound to the c terminus of gkap
PDB DOI: 10.2210/pdb5ovc/pdb
Classification: PROTEIN BINDING Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-08-28 Deposition Author(s): Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.
Pdz domain from rat shank3 bound to the c terminus of gkap
Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.
Primary Citation of Related Structures: 5OVC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 3 | A | 96 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT |
GKAP C terminus, synthetic peptide | B | 7 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XEAQTRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-28 Deposition Author(s): Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.