Streptomyces pac13 (h42q) with uridine
PDB DOI: 10.2210/pdb5oo8/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Streptomyces Coeruleorubidus
Deposited: 2017-08-06 Deposition Author(s): Chung, C. , Michailidou, F.
Streptomyces pac13 (h42q) with uridine
Primary Citation of Related Structures: 5OO8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative cupin_2 domain-containing isomerase | A | 124 | Streptomyces Coeruleorubidus | GSHMTKYKYTVEESERFNKHGIDLTVYGQVDPSATVVRVSVERGQFQEFFNVRSSYTYYVVSGQGVFYLNSEAVPAGATDLITVPPNTRIHYFGSMEMVLTVAPAFNEQDERHVRFISESESPY |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-06 Deposition Author(s): Chung, C. , Michailidou, F.