The cryofrozen atomic resolution x-ray crystal structure of the reduced form (fe2+) perdeuterated pyrococcus furiosus rubredoxin in d2o (100k, 0.75 angstrom resolution)
PDB DOI: 10.2210/pdb5ome/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1)
Deposited: 2017-07-31 Deposition Author(s): Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P. , Mossou, E.
Method: X-RAY DIFFRACTION Resolution: 0.747 Å
The cryofrozen atomic resolution x-ray crystal structure of the reduced form (fe2+) perdeuterated pyrococcus furiosus rubredoxin in d2o (100k, 0.75 angstrom resolution)
Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P. , Mossou, E.
Primary Citation of Related Structures: 5OME
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 54 | Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1) | MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-31 Deposition Author(s): Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P. , Mossou, E.