Crystal structure of gurmarin, a sweet taste suppressing polypeptide
PDB DOI: 10.2210/pdb5oll/pdb
Classification: PLANT PROTEIN Organism(s): Gymnema Sylvestre
Deposited: 2017-07-28 Deposition Author(s): Briand, L. , Legrand, P. , Neiers, F. , Roblin, P. , Sigoillot, M.
Crystal structure of gurmarin, a sweet taste suppressing polypeptide
Briand, L. , Legrand, P. , Neiers, F. , Roblin, P. , Sigoillot, M.
Primary Citation of Related Structures: 5OLL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gurmarin | A | 35 | Gymnema Sylvestre | EQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-28 Deposition Author(s): Briand, L. , Legrand, P. , Neiers, F. , Roblin, P. , Sigoillot, M.