Putative inactive (dormant) dimeric state of ghr transmembrane domain
PDB DOI: 10.2210/pdb5ohd/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2017-07-15 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Urban, A.S.
Putative inactive (dormant) dimeric state of ghr transmembrane domain
Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Urban, A.S.
Primary Citation of Related Structures: 5OHD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Growth hormone receptor | A | 43 | Salmonella Enterica | GSMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK |
Growth hormone receptor | B | 43 | Salmonella Enterica | GSMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK |
Method: SOLUTION NMR
Deposited Date: 2017-07-15 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Urban, A.S.