5OC6
Crystal structure of human trna-dihydrouridine(20) synthase dsrbd in complex with a 22 nucleotide dsrna
PDB DOI: 10.2210/pdb5oc6/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-06-29 Deposition Author(s): Bou-Nader, C. , Hamdane, D. , Pecqueur, L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 3.2 Å
Crystal structure of human trna-dihydrouridine(20) synthase dsrbd in complex with a 22 nucleotide dsrna
Bou-Nader, C. , Hamdane, D. , Pecqueur, L.
Primary Citation of Related Structures: 5OC6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| tRNA-dihydrouridine(20) synthase [NAD(P)+]-like | A | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKHHHHHH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-29 Deposition Author(s): Bou-Nader, C. , Hamdane, D. , Pecqueur, L.