Nmr spatial structure of her2 tm domain dimer in dpc micelles.
PDB DOI: 10.2210/pdb5ob4/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2017-06-26 Deposition Author(s): Arseniev, A.S. , Mineev, K.S.
Nmr spatial structure of her2 tm domain dimer in dpc micelles.
Primary Citation of Related Structures: 5OB4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Receptor tyrosine-protein kinase erbB-2 | A | 44 | Homo Sapiens | GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |
Receptor tyrosine-protein kinase erbB-2 | B | 44 | Homo Sapiens | GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK |
Method: SOLUTION NMR
Deposited Date: 2017-06-26 Deposition Author(s): Arseniev, A.S. , Mineev, K.S.