Unconventional sh3 domain from the postsynaptic density scaffold protein shank3
PDB DOI: 10.2210/pdb5o99/pdb
Classification: PROTEIN BINDING Organism(s): Pandinus Imperator
Deposited: 2017-06-16 Deposition Author(s): Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.
Method: X-RAY DIFFRACTION Resolution: 0.871 Å
Unconventional sh3 domain from the postsynaptic density scaffold protein shank3
Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.
Primary Citation of Related Structures: 5O99
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 3 | B | 60 | Pandinus Imperator | SVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQ |
SH3 and multiple ankyrin repeat domains protein 3 | A | 60 | Pandinus Imperator | SVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-16 Deposition Author(s): Boeckers, T.M. , Kursula, P. , Myllykoski, M. , Ponna, S.K.