Difference-refined excited-state structure of rsegfp2 1ps following 400nm-laser irradiation of the off-state.
PDB DOI: 10.2210/pdb5o8b/pdb
Classification: FLUORESCENT PROTEIN Organism(s): Aequorea Victoria
Deposited: 2017-06-12 Deposition Author(s): Adam, V. , Aquila, A. , Barends, T.R.M. , Bourgeois, D. , Boutet, S. , Byrdin, M. , Cammarata, M. , Carbajo, S. , Colletier, J.P. , Coquelle, N. , De La Mora, E. , Demachy, I. , Doak, R.B. , Feliks, M. , Field, M. , Fieschi, F. , Foucar, L. , Guillon, V. , Hilpert, M. , Hunter, M. , Jakobs, S. , Koglin, J.E. , Kovacsova, G. , Lane, T.J. , Levy, B. , Liang, M. , Nass, K. , Ridard, J. , Robinson, J.S. , Roome, C.M. , Ruckebusch, C. , Schiro, G. , Schlichting, I. , Seaberg, M. , Shoeman, R.L. , Sliwa, M. , Thepaut, M. , Weik, M. , Woodhouse, J.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Difference-refined excited-state structure of rsegfp2 1ps following 400nm-laser irradiation of the off-state.
Adam, V. , Aquila, A. , Barends, T.R.M. , Bourgeois, D. , Boutet, S. , Byrdin, M. , Cammarata, M. , Carbajo, S. , Colletier, J.P. , Coquelle, N. , De La Mora, E. , Demachy, I. , Doak, R.B. , Feliks, M. , Field, M. , Fieschi, F. , Foucar, L. , Guillon, V. , Hilpert, M. , Hunter, M. , Jakobs, S. , Koglin, J.E. , Kovacsova, G. , Lane, T.J. , Levy, B. , Liang, M. , Nass, K. , Ridard, J. , Robinson, J.S. , Roome, C.M. , Ruckebusch, C. , Schiro, G. , Schlichting, I. , Seaberg, M. , Shoeman, R.L. , Sliwa, M. , Thepaut, M. , Weik, M. , Woodhouse, J.
Primary Citation of Related Structures: 5O8B
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Green fluorescent protein | A | 248 | Aequorea Victoria | HHHHHHTDPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLAYGVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-12 Deposition Author(s): Adam, V. , Aquila, A. , Barends, T.R.M. , Bourgeois, D. , Boutet, S. , Byrdin, M. , Cammarata, M. , Carbajo, S. , Colletier, J.P. , Coquelle, N. , De La Mora, E. , Demachy, I. , Doak, R.B. , Feliks, M. , Field, M. , Fieschi, F. , Foucar, L. , Guillon, V. , Hilpert, M. , Hunter, M. , Jakobs, S. , Koglin, J.E. , Kovacsova, G. , Lane, T.J. , Levy, B. , Liang, M. , Nass, K. , Ridard, J. , Robinson, J.S. , Roome, C.M. , Ruckebusch, C. , Schiro, G. , Schlichting, I. , Seaberg, M. , Shoeman, R.L. , Sliwa, M. , Thepaut, M. , Weik, M. , Woodhouse, J.