Crystal structure of tia-1 rrm2 in complex with rna
PDB DOI: 10.2210/pdb5o3j/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-05-24 Deposition Author(s): Hennig, J. , Jagtap, P.K.A. , Sattler, M. , Sonntag, M.
Crystal structure of tia-1 rrm2 in complex with rna
Hennig, J. , Jagtap, P.K.A. , Sattler, M. , Sonntag, M.
Primary Citation of Related Structures: 5O3J
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nucleolysin TIA-1 isoform p40 | A | 80 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNW |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA (5'-R(P*UP*UP*C)-3') | b | 3 | NA | UUC |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-24 Deposition Author(s): Hennig, J. , Jagtap, P.K.A. , Sattler, M. , Sonntag, M.