Crystal structure of tarantula venom peptide protoxin-ii
PDB DOI: 10.2210/pdb5o0u/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2017-05-17 Deposition Author(s): Mccarthy, S. , Reyes, F.E. , Tabor, A.
Method: X-RAY DIFFRACTION Resolution: 0.99 Å
Crystal structure of tarantula venom peptide protoxin-ii
Mccarthy, S. , Reyes, F.E. , Tabor, A.
Primary Citation of Related Structures: 5O0U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta/omega-theraphotoxin-Tp2a | A | 30 | N.A. | YCQKWMWTCDSERKCCEGMVCRLWCKKKLW |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-17 Deposition Author(s): Mccarthy, S. , Reyes, F.E. , Tabor, A.