Twist and induce: dissecting the link between the enzymatic activity and the sapi inducing capacity of the phage 80 dutpase. d95e mutant from dutpase 80alpha phage.
PDB DOI: 10.2210/pdb5nz2/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Phage 80Alpha
Deposited: 2017-05-12 Deposition Author(s): Alite, C. , Ciges-Tomas, J.R. , Donderis, J. , Humphrey, S. , Maiques, E. , Marina, A. , Penades, J.R.
Twist and induce: dissecting the link between the enzymatic activity and the sapi inducing capacity of the phage 80 dutpase. d95e mutant from dutpase 80alpha phage.
Alite, C. , Ciges-Tomas, J.R. , Donderis, J. , Humphrey, S. , Maiques, E. , Marina, A. , Penades, J.R.
Primary Citation of Related Structures: 5NZ2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DUTPase | A | 170 | Staphylococcus Phage 80Alpha | MTNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNEHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSERGEKGFGSSGV |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-12 Deposition Author(s): Alite, C. , Ciges-Tomas, J.R. , Donderis, J. , Humphrey, S. , Maiques, E. , Marina, A. , Penades, J.R.